- Home
- Box Office
- #malavikanair-telugucinema-malayalamactress-cuckoo-mahanati-filmfareawardwinner-southindiancinema-actresslife-upcomingfilms-krishnampranayasakhi
#malavikanair-telugucinema-malayalamactress-cuckoo-mahanati-filmfareawardwinner-southindiancinema-actresslife-upcomingfilms-krishnampranayasakhi
Chiranjeevi steps in to settle Telugu cinema percentage war
Chiranjeevi is expected to meet Telangana exhibitors at 4 PM today to discuss the ongoing percentage system dispute. Chiranjeevi has reportedly stepped in to address the ongoing percentage system dispute between Telangan...
Chiranjeevi steps in to settle Telugu cinema percentage war
Chiranjeevi is expected to meet Telangana exhibitors at 4 PM today to discuss the ongoing percentage system dispute. Chiranjeevi has reportedly stepped in to address the ongoing percentage system dispute between Telangan...
Balakrishna urges Telugu industry to support exhibitors
Balakrishna speaks on exhibitors’ struggle The ongoing issue between exhibitors and producers or distributors in the Telugu film industry has become a serious concern, and Nandamuri Balakrishna has now reacted to it wi...
Balakrishna urges Telugu industry to support exhibitors
Balakrishna speaks on exhibitors’ struggle The ongoing issue between exhibitors and producers or distributors in the Telugu film industry has become a serious concern, and Nandamuri Balakrishna has now reacted to it wi...
Hellallallo from Peddi turns into a mass dance storm
Hellallallo gives Peddi a massive promotional high Peddi has taken its musical promotions to a new level with Hellallallo, a high-energy dance number that has already become one of the most talked-about updates from the ...
Hellallallo from Peddi turns into a mass dance storm
Hellallallo gives Peddi a massive promotional high Peddi has taken its musical promotions to a new level with Hellallallo, a high-energy dance number that has already become one of the most talked-about updates from the ...
Manchu Manoj Turns Villain in NBK111 With Dark Role
Manchu Manoj is set to surprise fans with a dark, negative role in NBK111 alongside Balakrishna, directed by Gopichand Malineni. The announcement on his birthday has created massive excitement, promising intense scenes a...
Manchu Manoj Turns Villain in NBK111 With Dark Role
Manchu Manoj is set to surprise fans with a dark, negative role in NBK111 alongside Balakrishna, directed by Gopichand Malineni. The announcement on his birthday has created massive excitement, promising intense scenes a...
Ram Charan Janhvi Kapoor Peddi Honors Chiranjeevi Sridevi Legacy
Ram Charan and Janhvi Kapoor recalled the cinematic legacy of Chiranjeevi and Sridevi at the Peddi trailer launch in Mumbai. The pairing evokes nostalgia and connects audiences to Telugu cinema heritage. At the highly an...
Ram Charan Janhvi Kapoor Peddi Honors Chiranjeevi Sridevi Legacy
Ram Charan and Janhvi Kapoor recalled the cinematic legacy of Chiranjeevi and Sridevi at the Peddi trailer launch in Mumbai. The pairing evokes nostalgia and connects audiences to Telugu cinema heritage. At the highly an...
Kamal Haasan’s Economy Travel Before Kalki 2 Shoot Wins Attention
Kamal Haasan reportedly travelled in economy class instead of using a chartered flight while heading for Kalki 2898 AD sequel shoot work between Chennai and Hyderabad. Kamal Haasan has once again proved that stardom is n...
Kamal Haasan’s Economy Travel Before Kalki 2 Shoot Wins Attention
Kamal Haasan reportedly travelled in economy class instead of using a chartered flight while heading for Kalki 2898 AD sequel shoot work between Chennai and Hyderabad. Kamal Haasan has once again proved that stardom is n...
NTR Fans Celebrate with Exclusive Updates on Upcoming Films for Birthday
The excitement surrounding Young Tiger NTR's birthday is reaching fever pitch among his fans. His birthday, scheduled for May 20th, has fans eagerly awaiting not just celebrations but exclusive updates on his upcoming pr...
NTR Fans Celebrate with Exclusive Updates on Upcoming Films for Birthday
The excitement surrounding Young Tiger NTR's birthday is reaching fever pitch among his fans. His birthday, scheduled for May 20th, has fans eagerly awaiting not just celebrations but exclusive updates on his upcoming pr...
Adivi Sesh’s Dacoit Dominates OTT Charts Across India
Adivi Sesh’s latest thriller Dacoit is continuing its winning streak by dominating OTT charts across India after a successful theatrical run. Adivi Sesh has consistently earned praise for selecting unique and content-d...
Adivi Sesh’s Dacoit Dominates OTT Charts Across India
Adivi Sesh’s latest thriller Dacoit is continuing its winning streak by dominating OTT charts across India after a successful theatrical run. Adivi Sesh has consistently earned praise for selecting unique and content-d...
Vidya Balan to Reunite with Balakrishna in Koratala Siva's Upcoming Film?
Nandamuri Balakrishna’s next project with director Koratala Siva is already sparking excitement in the film industry. The duo is collaborating for the first time, and the anticipation surrounding the project continues ...
Vidya Balan to Reunite with Balakrishna in Koratala Siva's Upcoming Film?
Nandamuri Balakrishna’s next project with director Koratala Siva is already sparking excitement in the film industry. The duo is collaborating for the first time, and the anticipation surrounding the project continues ...
Prabhas Starrer Spirit Confirms Release Date: Set for March 2027 Premiere
Putting an end to the rumors surrounding its release, the makers of the much-anticipated film Spirit starring Prabhas have officially confirmed that the movie will release on March 5, 2027, as originally scheduled. This ...
Prabhas Starrer Spirit Confirms Release Date: Set for March 2027 Premiere
Putting an end to the rumors surrounding its release, the makers of the much-anticipated film Spirit starring Prabhas have officially confirmed that the movie will release on March 5, 2027, as originally scheduled. This ...
Ishaan Khatter Announces Jugaadu: Everything You Need to Know About the Cast, Director, and More
Actor Ishaan Khatter has just announced his next exciting film, Jugaadu, which is set to be another highly anticipated project in his growing filmography. The film, which marks his collaboration with Punjabi actor Tania,...
Ishaan Khatter Announces Jugaadu: Everything You Need to Know About the Cast, Director, and More
Actor Ishaan Khatter has just announced his next exciting film, Jugaadu, which is set to be another highly anticipated project in his growing filmography. The film, which marks his collaboration with Punjabi actor Tania,...
Anirudh's Collaboration with Balayya: A Challenging Task Ahead
Nandamuri Balakrishna, one of the most prominent stars in Telugu cinema, is currently in discussions with multiple filmmakers for his upcoming projects. One of the most talked-about collaborations is with director Korata...
Anirudh's Collaboration with Balayya: A Challenging Task Ahead
Nandamuri Balakrishna, one of the most prominent stars in Telugu cinema, is currently in discussions with multiple filmmakers for his upcoming projects. One of the most talked-about collaborations is with director Korata...
Chiranjeevi Bobby Film Starts With Interval Action Sequence Targets Sankranthi 2027
Chiranjeevi and K S Ravindra’s film will begin shooting with a high-voltage interval action sequence. The big-budget project is being planned for a grand Sankranthi 2027 theatrical release. Chiranjeevi’s much-awaited...
Chiranjeevi Bobby Film Starts With Interval Action Sequence Targets Sankranthi 2027
Chiranjeevi and K S Ravindra’s film will begin shooting with a high-voltage interval action sequence. The big-budget project is being planned for a grand Sankranthi 2027 theatrical release. Chiranjeevi’s much-awaited...
Akhil Akkineni Lenin Gets Big Boost From Nagarjuna Ahead Of Release
Nagarjuna has expressed strong confidence in his son Akhil Akkineni’s upcoming film Lenin after watching its first cut. Taking to social media, the veteran actor said audiences are about to witness a completely new ver...
Akhil Akkineni Lenin Gets Big Boost From Nagarjuna Ahead Of Release
Nagarjuna has expressed strong confidence in his son Akhil Akkineni’s upcoming film Lenin after watching its first cut. Taking to social media, the veteran actor said audiences are about to witness a completely new ver...
Aditya Dhar Plans Big Film With Ranveer Singh After Dhurandhar Success
Aditya Dhar is developing a new big-budget film and is in talks with Ranveer Singh for the lead role. The project is in early stages and is expected to begin shooting around 2027 if finalised. Aditya Dhar is reportedly w...
Aditya Dhar Plans Big Film With Ranveer Singh After Dhurandhar Success
Aditya Dhar is developing a new big-budget film and is in talks with Ranveer Singh for the lead role. The project is in early stages and is expected to begin shooting around 2027 if finalised. Aditya Dhar is reportedly w...
Maa Inti Bangaram Slows Down Promotions: Fans Express Concern
Maa Inti Bangaram Needs Stronger Promotions to Keep the Buzz Alive Maa Inti Bangaram, starring Samantha Ruth Prabhu, began its promotional journey with a strong start. The first teaser created a lot of buzz, and the rele...
Maa Inti Bangaram Slows Down Promotions: Fans Express Concern
Maa Inti Bangaram Needs Stronger Promotions to Keep the Buzz Alive Maa Inti Bangaram, starring Samantha Ruth Prabhu, began its promotional journey with a strong start. The first teaser created a lot of buzz, and the rele...
Shruti Haasan Confirmed for Peddi's Special Song: A Big Challenge for Buchi Babu
Shruti Haasan Joins Peddi's Special Song Amid High Expectations After weeks of speculation, Shruti Haasan has been confirmed for a special song in the much-anticipated film Peddi, starring Ram Charan. Initially, there we...
Shruti Haasan Confirmed for Peddi's Special Song: A Big Challenge for Buchi Babu
Shruti Haasan Joins Peddi's Special Song Amid High Expectations After weeks of speculation, Shruti Haasan has been confirmed for a special song in the much-anticipated film Peddi, starring Ram Charan. Initially, there we...
Krithi Shetty Joins Anil Ravipudi Film, Keerthy Suresh Likely Opposite Venkatesh
Director Anil Ravipudi’s upcoming multi-starrer is already creating strong buzz in Telugu cinema, with exciting casting updates grabbing attention. The film, which features Venkatesh Daggubati and Nandamuri Kalyanram i...
Krithi Shetty Joins Anil Ravipudi Film, Keerthy Suresh Likely Opposite Venkatesh
Director Anil Ravipudi’s upcoming multi-starrer is already creating strong buzz in Telugu cinema, with exciting casting updates grabbing attention. The film, which features Venkatesh Daggubati and Nandamuri Kalyanram i...
Chiru Glimpse: Unique Dextrocardia Story With Emotional Twist Impresses
The glimpse of Chiru has caught audience attention with its unique concept and emotional storytelling. The film, introduced at a grand launch event, began its journey with the unveiling of the title and first look poster...
Chiru Glimpse: Unique Dextrocardia Story With Emotional Twist Impresses
The glimpse of Chiru has caught audience attention with its unique concept and emotional storytelling. The film, introduced at a grand launch event, began its journey with the unveiling of the title and first look poster...
Maa Inti Bangaaram | Samantha | Latest Telugu Movie Lyrical
The upcoming film Maa Inti Bangaaram has begun its promotional journey on a high note with the release of its first single, Thassadiya. Featuring Samantha Ruth Prabhu in the lead role, the song has quickly caught the att...
Maa Inti Bangaaram | Samantha | Latest Telugu Movie Lyrical
The upcoming film Maa Inti Bangaaram has begun its promotional journey on a high note with the release of its first single, Thassadiya. Featuring Samantha Ruth Prabhu in the lead role, the song has quickly caught the att...









